Welcome  

 

Caseicin C [id=CAA0006]

Synonym: Alphas1-casein f(195-208)

Producer Organism : Native Protein : Production Method :
Cow αs1-casein Enzymatic hydrolysis and Purification with LC method
Activity : Antibacterial
Target Organisms :

Gram-positive: Active against Listeria innocua DPC3306 at 0.05 mM.

NOTE: No activity against Lactobacillus bulgaricus ATCC 11842 DPC5383, Staphylococcus aureus DPC5246, Streptococcus mutans DPC4069, Escherichia coli JM109 DPC6053, Escherichia coli O157:H7 DPC6054, Escherichia coli O157:H7 DPC6055, Enterobacter sakazakii ATCC 12868 DPC6090, Enterobacter sakazakii NCTC 8155 DPC6091 at 0.05 mM .

Description :
Production method: Lactobacillus acidophilus DPC6026 proteinase hydrolysis and purification with LC method.

Length : 14 Mass (Da): 1 486.63 Common Amino Acids : S
Isolectric Point : 3.93 Net Charge : -2 Absent Amino Acids : ACFHLMQRTVWY
Basic Residues : 1 Acidic Residues : 3 Hydrophobic Residues : 2
Polar Residues : 6 Boman Index : -40.59 Hydropathy Index : -1.314
Aliphatic Index : 55.71 Instability Index : 0 Extinction Coefficient :
Absorbance 280nm : 0

Wheel representation

Hydrophobicity plot

Red solid plot : values according to the hydrophobicity scale of Kyte and Doolittle (reference paper).
Yellow dashed plot : Experimentally determined hydrophobicity scale for proteins at membrane interfaces(reference paper).
Green dotted-dashed plot : prediction of transmembrane helices (reference paper). In this scale (unlike the others), more negative values reflect greater hydrophobicity.

Multiple Sequence Alignment (MSA)


 1 CAANATIVE 100.0%  KTKLTEEEKNRLNFLKKISQRYQKFALPQYLKTVYQHQKAMKPWIQPKTKVIPYVRYL 
 2 CAA0020   100.0%  ---------------------------------VYQHQKAMKPWIQPKTKVIPYVRYL 
 3 CAA0021   100.0%  ---------------------------------VYQHQKAMKPWIQPKTKVIPYVRYL 
 4 CAA0019   100.0%  -------------------------------KTVYQHQKAMKPWIQPKTKVIPYVRYL 
 5 CAA0018   100.0%  ------------------------------LKTVYQHQKAMKPWIQPKTKVIPYVRYL 
 6 CAA0017   100.0%  -------------------------ALPQYLKTVYQHQKAMKPWIQPKTKVIPYVRYL 
 7 CAA0015   100.0%  ----------------------QKFALPQYLKTVYQHQKAMKPWIQPKTKVIPYVRYL 
 8 CAA0014   100.0%  --------------LKKISQRYQKFALPQYLKTVYQHQKAMKPWIQPKTKVIPYVRYL 
 9 CAA0009   100.0%  --------KNRLNFLKKISQRYQKFALPQYLKTVYQHQK------------------- 

10 CAA0013   100.0%  --------------LKKISQRYQKFALPQY---------------------------- 

11 CAA0008   100.0%  --------KNRLNFLKKISQRYQ----------------------------------- 

12 CAA0010   100.0%  KTKLTEEEKNRLNFLKKISQRYQKFALPQYLKTVYQHQK------------------- 

13 CAA0011   100.0%  KTKLTEEEKNRLNFLKKISQRYQKFALPQYLKTVYQHQK------------------- 

14 CAA0007    97.4%  -TKITEEEKNRLNFLKKISQRYQKFALPQYLKTVYQHQK------------------- 

15 CAA0012   100.0%  --------------------RYQKFALPQYLKTVYQHQK------------------- 

16 CAA0016   100.0%  ------------------------FALPQYLK-------------------------- 

Citation: 1

Casein-derived antimicrobial peptides generated by Lactobacillus acidophilus DPC6026

Cited Entries: CAA0003, CAA0004, CAA0006

Authors:Hayes, M., Ross, R.P., Fitzgerald, G.F., Hill, C., Stanton, C.
Journal: Applied and Environmental Microbiology 2006, 72(3).
Abstract: Three peptides produced by a Lactobacillus acidophilus DPC6026 fermentation of sodium caseinate and showing antibacterial activity against pathogenic strains Enterobacter sakazakii ATCC 12868 and Escherichia coli DPC5063 were characterized. These peptides were all generated from bovine {alpha}s1-casein and identified as IKHQGLPQE, VLNENLLR, and SDIPNPIGSENSEK. These peptides may have bioprotective applicability and potential use in milk-based formula, which has been linked to E. sakazakii infection in neonates.

Go to top