Welcome  

 

αs2-casein f(151-189) [id=CAA0007]

Synonym: Casocidin 2-39

Producer Organism : Native Protein : Production Method :
Cow αs2-casein Acetic acid treatment and Purification
Activity : Not determined
Target Organisms :

Unavailable data

Description :
Production method: Acetic acid treatment and purification.

Patent
Length : 38 Mass (Da): 4 743.13 Common Amino Acids : K
Isolectric Point : 10.6 Net Charge : 7 Absent Amino Acids : CDGMW
Basic Residues : 10 Acidic Residues : 3 Hydrophobic Residues : 10
Polar Residues : 9 Boman Index : -104.96 Hydropathy Index : -1.239
Aliphatic Index : 71.84 Instability Index : 0 Extinction Coefficient : 4470
Absorbance 280nm : 120.81

Wheel representation

Hydrophobicity plot

Red solid plot : values according to the hydrophobicity scale of Kyte and Doolittle (reference paper).
Yellow dashed plot : Experimentally determined hydrophobicity scale for proteins at membrane interfaces(reference paper).
Green dotted-dashed plot : prediction of transmembrane helices (reference paper). In this scale (unlike the others), more negative values reflect greater hydrophobicity.

Multiple Sequence Alignment (MSA)


 1 CAANATIVE 100.0%  KTKLTEEEKNRLNFLKKISQRYQKFALPQYLKTVYQHQKAMKPWIQPKTKVIPYVRYL 
 2 CAA0020   100.0%  ---------------------------------VYQHQKAMKPWIQPKTKVIPYVRYL 
 3 CAA0021   100.0%  ---------------------------------VYQHQKAMKPWIQPKTKVIPYVRYL 
 4 CAA0019   100.0%  -------------------------------KTVYQHQKAMKPWIQPKTKVIPYVRYL 
 5 CAA0018   100.0%  ------------------------------LKTVYQHQKAMKPWIQPKTKVIPYVRYL 
 6 CAA0017   100.0%  -------------------------ALPQYLKTVYQHQKAMKPWIQPKTKVIPYVRYL 
 7 CAA0015   100.0%  ----------------------QKFALPQYLKTVYQHQKAMKPWIQPKTKVIPYVRYL 
 8 CAA0014   100.0%  --------------LKKISQRYQKFALPQYLKTVYQHQKAMKPWIQPKTKVIPYVRYL 
 9 CAA0009   100.0%  --------KNRLNFLKKISQRYQKFALPQYLKTVYQHQK------------------- 

10 CAA0013   100.0%  --------------LKKISQRYQKFALPQY---------------------------- 

11 CAA0008   100.0%  --------KNRLNFLKKISQRYQ----------------------------------- 

12 CAA0010   100.0%  KTKLTEEEKNRLNFLKKISQRYQKFALPQYLKTVYQHQK------------------- 

13 CAA0011   100.0%  KTKLTEEEKNRLNFLKKISQRYQKFALPQYLKTVYQHQK------------------- 

14 CAA0007    97.4%  -TKITEEEKNRLNFLKKISQRYQKFALPQYLKTVYQHQK------------------- 

15 CAA0012   100.0%  --------------------RYQKFALPQYLKTVYQHQK------------------- 

16 CAA0016   100.0%  ------------------------FALPQYLK-------------------------- 

Citation: 1

Antibiotic peptides from bovine milk

Cited Entries: CAA0007, CAA0008, CAA0009, CAA0011, CAA0012

Authors:Forssmann, W.-G., Zucht, H.-D., Raida, M., Adermann, K., Magert, H.J.
Journal: Us 6,579,849 B2 1998, Jun.17, 2003.
Abstract: A peptide having the amino acid sequence H2NX1RX3X2COOH (formula I) wherein X1 is either zero or X1 and/or X2 are a residue representing at least five amino acid residues (symbolized in the one letter amino acid code), preferably naturally occurring amino acids, with the proviso that X1 and/or X2 contain at least one basic amino acid residue immediately followed by a hydrophobic amino acid residue and X1 and/or X2 contain at least one glutamine residue.

Go to top