Welcome  

 

Casocidin-I [id=CAA0010]

Synonym: Alphas2-casein f(165-203)

Producer Organism : Native Protein : Production Method :
Cow αs2-casein Enzymatic hydrolysis and Purification with LC method/Synthetic
Activity : Antibacterial
Target Organisms :

Gram-positive: Active against Staphylococcus carnosus TM300 (no MIC).

Gram-negative: Active against Escherichia coli XL1, Escherichia coli BL21 DE3 (no MIC).

Description :
Production method: Serine proteases hydrolysis and purification with LC method/Synthetic.

Length : 40 Mass (Da): 4 871.31 Common Amino Acids : K
Isolectric Point : 10.71 Net Charge : 8 Absent Amino Acids : CDGMW
Basic Residues : 11 Acidic Residues : 3 Hydrophobic Residues : 10
Polar Residues : 9 Boman Index : -110.51 Hydropathy Index : -1.293
Aliphatic Index : 68.25 Instability Index : 0 Extinction Coefficient : 4470
Absorbance 280nm : 114.62

Wheel representation

Hydrophobicity plot

Red solid plot : values according to the hydrophobicity scale of Kyte and Doolittle (reference paper).
Yellow dashed plot : Experimentally determined hydrophobicity scale for proteins at membrane interfaces(reference paper).
Green dotted-dashed plot : prediction of transmembrane helices (reference paper). In this scale (unlike the others), more negative values reflect greater hydrophobicity.

Multiple Sequence Alignment (MSA)


 1 CAANATIVE 100.0%  KTKLTEEEKNRLNFLKKISQRYQKFALPQYLKTVYQHQKAMKPWIQPKTKVIPYVRYL 
 2 CAA0020   100.0%  ---------------------------------VYQHQKAMKPWIQPKTKVIPYVRYL 
 3 CAA0021   100.0%  ---------------------------------VYQHQKAMKPWIQPKTKVIPYVRYL 
 4 CAA0019   100.0%  -------------------------------KTVYQHQKAMKPWIQPKTKVIPYVRYL 
 5 CAA0018   100.0%  ------------------------------LKTVYQHQKAMKPWIQPKTKVIPYVRYL 
 6 CAA0017   100.0%  -------------------------ALPQYLKTVYQHQKAMKPWIQPKTKVIPYVRYL 
 7 CAA0015   100.0%  ----------------------QKFALPQYLKTVYQHQKAMKPWIQPKTKVIPYVRYL 
 8 CAA0014   100.0%  --------------LKKISQRYQKFALPQYLKTVYQHQKAMKPWIQPKTKVIPYVRYL 
 9 CAA0009   100.0%  --------KNRLNFLKKISQRYQKFALPQYLKTVYQHQK------------------- 

10 CAA0013   100.0%  --------------LKKISQRYQKFALPQY---------------------------- 

11 CAA0008   100.0%  --------KNRLNFLKKISQRYQ----------------------------------- 

12 CAA0010   100.0%  KTKLTEEEKNRLNFLKKISQRYQKFALPQYLKTVYQHQK------------------- 

13 CAA0011   100.0%  KTKLTEEEKNRLNFLKKISQRYQKFALPQYLKTVYQHQK------------------- 

14 CAA0007    97.4%  -TKITEEEKNRLNFLKKISQRYQKFALPQYLKTVYQHQK------------------- 

15 CAA0012   100.0%  --------------------RYQKFALPQYLKTVYQHQK------------------- 

16 CAA0016   100.0%  ------------------------FALPQYLK-------------------------- 

Citation: 1

Casocidin-I: a casein-alphas2 derived peptide exhibits antibacterial activity

Cited Entries: CAA0010

Authors:Zucht, H.-D., Raida, M., Adermann, K., Mgert, H.-J., Forssmann, W.-G.
Journal: FEBS Letters 1995, 372(2-3).
CrossRef External Link
Abstract: Here we report the isolation and characterization of an antibacterial peptide from bovine milk inhibiting the growth of Escherichia coli, and Staphylococcus carnosus. The primary structure of the peptide was revealed as a 39-amino-acid-containing fragment of bovine αs2-casein (position 165203) by means of Edman amino acid sequencing and mass spectrometry. Since human milk does not contain any casein-αs2, these findings could explain the different influence of human and bovine milk on the gastrointestinal flora of the suckling.
Keywords: Antibacterial; Peptide; Milk; Casein; Intestinal flora

Go to top