Welcome  

 

LF f(1-9) [id=LFH0003]

Synonym: HPL-9

Producer Organism : Native Protein : Production Method :
Human Lactoferrin (LF) Synthetic
Activity : Antibacterial
Target Organisms :

Gram-positive: Enterococcus faecalis 19433 (MIC=833 然), Enterococcus faecium 6569 (MIC=1250 然), Lactobacillus lactis subsp. lactis 29146 (MIC=833 然), Staphylococcus aureus oxford (MIC=1250 然), Staphylococcus aureus 700698 (MIC=1250 然).

Gram-negative: Escherichia coli serotype O111 8007 (MIC=2500 然), Escherichia coli MLK986 (MIC=2500 然), Klebsiella pneumoniae subsp. pneumoniae 49472 (MIC=1250 然), Acinetobacter sp. 1421 (MIC=313 然), Salmonella typhimurium 13311 (MIC=1250 然).

NOTE: No activity against Escherichia coli K12 W3110, Escherichia coli K12 D21, Escherichia coli K12 D21e19, Escherichia coli K12 D21e7, Escherichia coli K12 D21f1, Escherichia coli K12 D21f2, Escherichia coli MLK53, Escherichia coli MLK1067, Escherichia coli WA707, Escherichia coli WA834 (>2500 然) .

Description :
Production method: Synthetic.

Nine peptides (LFH0002, LFH0003, LFH0016, LFH0045, LFH0056, LFH0057, LFH0058, LFH0059) derived from human lactoferricin are tested against a selection of Gram-positive and Gram-negative strains. Four of these peptides, LFH0003, LFH0016, LFH0026 and LFH0045, were active against all of the 9 bacterial strains examined, while LFH0002 and LFH0059 exhibited strain specific activity (Citation: 1).
Synthetic peptides derived from human and bovine lactoferricin, as well as tritrpticin sequences, were assayed for antimicrobial activity against wild-type Escherichia coli and LPS mutant strains. Antimicrobial activity was only obtained with peptides derived from the bovine lactoferricin sequence (LFH0016, LFH0017, LFH0018, LFH0019 and LFH0020) and peptides corresponding to chimeras of human (LFH0081 and LFH0082) and bovine sequences (LFB0031, LFB0041 and LFB0046). None of the peptides corresponding to different regions of native human lactoferricin showed any antimicrobial activity. The results underline the importance of the content of tryptophan and arginine residues, and the relative location of these residues for antimicrobial activity (Citation: 2).
Length : 9 Mass (Da): 1 200.72 Common Amino Acids : R
Isolectric Point : 12.98 Net Charge : 4 Absent Amino Acids : ACDEFHIKLMNPTY
Basic Residues : 4 Acidic Residues : 0 Hydrophobic Residues : 2
Polar Residues : 2 Boman Index : -61.31 Hydropathy Index : -2.156
Aliphatic Index : 32.22 Instability Index : 0 Extinction Coefficient : 5500
Absorbance 280nm : 687.5

Wheel representation

Hydrophobicity plot

Red solid plot : values according to the hydrophobicity scale of Kyte and Doolittle (reference paper).
Yellow dashed plot : Experimentally determined hydrophobicity scale for proteins at membrane interfaces(reference paper).
Green dotted-dashed plot : prediction of transmembrane helices (reference paper). In this scale (unlike the others), more negative values reflect greater hydrophobicity.

Multiple Sequence Alignment (MSA)

 1 LFH0010  100.0%  GRRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCIQA 
 2 LFH0016  100.0%  -----------------TKCFQWQRN----------------------- 
 3 LFH0020   88.9%  -----------------TKCFQWQGN----------------------- 
 4 LFH0017   88.9%  -----------------TKCGQWQRN----------------------- 
 5 LFH0018   77.8%  -----------------TKCFGWGRN----------------------- 
 6 LFH0019   88.9%  -----------------TGCFQWQRN----------------------- 
 7 LFH0011  100.0%  -------------QPEATKCFQWQRNMRKVR------------------ 
 8 LFH0012  100.0%  --------------PEATKCFQWQRNMRKVR------------------ 
 9 LFH0013  100.0%  ---------------EATKCFQWQRNMRKVR------------------ 
10 LFH0014  100.0%  ----------------ATKCFQWQRNMRKVR------------------ 
11 LFH0041   91.7%  -------------------CFQWQRNMRKVA------------------ 
12 LFH0043  100.0%  --------------------FQWQRNMRK-------------------- 
13 LFH0040   91.7%  -------------------CFQWQRNMRKAR------------------ 
14 LFH0015  100.0%  -----------------TKCFQWQRNMRKVR------------------ 
15 LFH0038   91.7%  -------------------CFQWQRNMAKVR------------------ 
16 LFH0039   91.7%  -------------------CFQWQRNMRAVR------------------ 
17 LFH0021  100.0%  -----------------TKCFQWQRNMRKVR------------------ 
18 LFH0027  100.0%  ------------------KCFQWQRNMRKVR------------------ 
19 LFH0030   91.7%  -------------------AFQWQRNMRKVR------------------ 
20 LFH0044  100.0%  --------------------FQWQRNMRKV------------------- 
21 LFH0049  100.0%  --------------------FQWQRNMRKVR------------------ 
22 LFH0045  100.0%  --------------------FQWQRNMRKVR------------------ 
23 LFH0031   91.7%  -------------------CAQWQRNMRKVR------------------ 
24 LFH0055  100.0%  ---------------------QWQRNMRKVR------------------ 
25 LFH0022  100.0%  -----------------TKCFQWQRNMRKVRG----------------- 
26 LFH0029  100.0%  -------------------CFQWQRNMRKVR------------------ 
27 LFH0033   91.7%  -------------------CFQAQRNMRKVR------------------ 
28 LFH0056  100.0%  ------------------------RNMRKVR------------------ 
29 LFH0032   91.7%  -------------------CFAWQRNMRKVR------------------ 
30 LFH0034   91.7%  -------------------CFQWARNMRKVR------------------ 
31 LFH0023   93.3%  -----------------TKCFQWQWNMRKVRG----------------- 
32 LFH0057  100.0%  ---------------------------RKVR------------------ 
33 LFH0035   91.7%  -------------------CFQWQANMRKVR------------------ 
34 LFH0036   91.7%  -------------------CFQWQRAMRKVR------------------ 
35 LFH0046   90.9%  --------------------FQWQRNIRKVR------------------ 
36 LFH0047   90.9%  --------------------FQWQRNIRKVR------------------ 
37 LFH0048   90.9%  --------------------FQWQRNPRKVR------------------ 
38 LFH0037   91.7%  -------------------CFQWQRNARKVR------------------ 
39 LFH0024  100.0%  -----------------TKCFQWQRNMRKVRGPPVSCIKR--------- 
40 LFH0026  100.0%  -----------------TKCFQWQRNMRKVRGPPVSCIKRDS------- 
41 LFH0025  100.0%  -----------------TKCFQWQRNMRKVRGPPVSCIKRDS------- 
42 LFH0042  100.0%  -------------------CFQWQRNMRKVRGPPVSCI----------- 
43 LFH0054  100.0%  --------------------FQWQRNMRKVRGPPVS------------- 
44 LFH0028  100.0%  ------------------KCFQWQRNMRKVRGPPVSCI----------- 
45 LFH0007  100.0%  GRRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCI-- 
46 LFH0058  100.0%  ---------------------------RKVRGPPVSCIKRDSP------ 
47 LFH0059  100.0%  ------------------------------------CIKRDSP------ 
48 LFH0009A 100.0%  GRRRRSVQWCA-------------------------------------- 
49 LFH0009B 100.0%  -----------VSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCI-- 
50 LFH0005  100.0%  GRRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCI-- 
51 LFH0004  100.0%  GRRRRSVQWCA-------------------------------------- 
52 LFH0003  100.0%  GRRRRSVQW---------------------------------------- 
53 LFH0002  100.0%  GRRRRS------------------------------------------- 
54 LFH0006   97.9%  GRRRRSVQWCAVSQPEATKCFQWQRNMRRVRGPPVSCIKRDSPIQCI-- 

Citation: 1

Factors contributing to the potency of antimicrobial cationic peptides from the N-terminal region of human lactoferrin

Cited Entries: LFH0002, LFH0003, LFH0016, LFH0017, LFH0018, LFH0019, LFH0020, LFH0026, LFH0045, LFH0056, LFH0057, LFH0058, LFH0059

Authors:Moriarty, L.C., Joannou, C.L., van den Berg, J.J.M., Gorinsky, B., Evans, R.W.
Journal: FEMS Microbiology Letters 2004, 239(2).
Abstract: This study investigated the antimicrobial activities of peptides derived from the N-terminal region of human lactoferrin, and examined the contributions of individual residues to the activity of the most potent peptide. Two regions of antimicrobial activity were identified, the first corresponding to a weakly active peptide, HLP-9, comprising residues 1-9, and a second corresponding to a more potent peptide, HLP-10, comprising residues 18-26 and containing the hexapeptide motif, FQWQRN. Inhibitory studies on peptides from the first region confirm the importance of tryptophan residues in enhancing and broadening peptide activity. Inhibitory studies with glycine-substituted homologues of the more potent peptide showed that F21/G and R25/G substitutions resulted in a major reduction or complete loss of activity, while increased peptide cationicity or flexibility had little effect. Our findings demonstrate that F21 and R25 are critical determinants of potency for HLP-10, and that the second aromatic residue may act synergistically with W23 in developing and enhancing the activity of this cationic peptide.
Keywords: Cationic antimicrobial peptides; Human lactoferrin peptide; Lactoferrin
Citation: 2

Interactions of lactoferricin-derived peptides with LPS and antimicrobial activity

Cited Entries: LFH0002, LFH0003, LFH0016, LFH0017, LFH0018, LFH0019, LFH0020, LFH0056, LFH0080, LFH0081, LFH0082, LFH0083, LFH0084, LFB0031, LFB0041, LFB0046, LFB0097

Authors:Farnaud, S., Spiller, C., Moriarty, L.C., Patel, A., Gant, V., Odell, E.W., Evans, R.W.
Journal: FEMS Microbiology Letters 2004, 233(2).
Keywords: Lactoferrin; Lactoferricin; Cationic antimicrobial peptides; Lps; Mbc

Go to top