Welcome  


Accession Sort A-Z Name Sort A-Z LengthSort A-Z MassSort A-Z StructureSort A-Z Net ChargeSort A-Z Sequence Sort A-Z pISort A-Z Absent AASort A-Z Common AASort A-Z Boman IndexSort A-Z Hydropathy IndexSort A-Z Aliphatic IndexSort A-Z Instability IndexSort A-Z Extinction CoefficientSort A-Z Absorbance 280Sort A-Z ASort A-Z CSort A-Z DSort A-Z ESort A-Z FSort A-Z GSort A-Z HSort A-Z ISort A-Z KSort A-Z LSort A-Z MSort A-Z NSort A-Z PSort A-Z QSort A-Z RSort A-Z SSort A-Z TSort A-Z VSort A-Z WSort A-Z YSort A-Z
LFH0001 Hydrolysate 0 18.02 Not determined 0 Not determined 6.11 ACDEFGHIKLMNPQRSTVWY RQPNSTYWVMLEDCFGKIHA 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0
LFH0002 LF f(1-6) 6 786.96 Not determined 4 GRRRRS 12.98 ACDEFHIKLMNPQTVWY R -62.14 -3.2 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 4 1 0 0 0 0
LFH0003 LF f(1-9) 9 1200.72 Not determined 4 GRRRRSVQW 12.98 ACDEFHIKLMNPTY R -61.31 -2.156 32.22 0 5500 687.5 0 0 0 0 0 1 0 0 0 0 0 0 0 1 4 1 0 1 1 0
LFH0004 LF f(1-11) 11 1374.94 Not determined 4 GRRRRSVQWCA 12.5 DEFHIKLMNPTY R -58.22 -1.373 35.45 0 5500 550 1 1 0 0 0 1 0 0 0 0 0 0 0 1 4 1 0 1 1 0
LFH0005 Lactoferricin H 47 5546.16 Not determined 9 GRRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCI 11.78 HLY R -150.52 -0.851 53.83 0 11250 244.57 2 4 1 1 1 2 0 3 3 0 1 1 4 5 8 4 1 4 2 0
LFH0006 Lactoferricin H 47 5574.18 Not determined 9 GRRRRSVQWCAVSQPEATKCFQWQRNMRRVRGPPVSCIKRDSPIQCI 11.99 HLY R -159.89 -0.864 53.83 0 11250 244.57 2 4 1 1 1 2 0 3 2 0 1 1 4 5 9 4 1 4 2 0
LFH0007 Lactoferricin H 47 5546.16 Not determined 9 GRRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCI 11.78 HLY R -150.52 -0.851 53.83 0 11250 244.57 2 4 1 1 1 2 0 3 3 0 1 1 4 5 8 4 1 4 2 0
LFH0008 Hydrolysate 47 5546.16 Not determined 9 Not determined 11.78 HLY R -150.52 -0.851 53.83 0 11250 244.57 2 4 1 1 1 2 0 3 3 0 1 1 4 5 8 4 1 4 2 0
LFH0009 Lactoferricin H 48 5546.16 Not determined 9 GRRRRSVQWCA/VSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCI 11.78 HLY R -150.52 -0.833 52.71 0 11250 239.36 2 4 1 1 1 2 0 3 3 0 1 1 4 5 8 4 1 4 2 0
LFH0010 Lactoferricin H 49 5745.65 1Z6V resolved by NMR.
1Z6W resolved by NMR.
9 GRRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCIQA 11.78 HLY R -154.25 -0.851 53.67 0 11250 234.38 3 4 1 1 1 2 0 3 3 0 1 1 4 6 8 4 1 4 2 0
    Records 1 to 10 of 405     
Page Size 
Go to top